Anti FAM166A pAb (ATL-HPA023307 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023307-25

• 

Protein Description: family with sequence similarity 166, member A
Gene Name: FAM166A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026969: 62%, ENSRNOG00000010019: 65%
Entrez Gene ID: 401565
Uniprot ID: Q6J272
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGVENIPRQILLPAGFTPDTPHPPCPPGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQRDEYPPPARRQQETLDVGSFQ
• Gene Sequence: PGVENIPRQILLPAGFTPDTPHPPCPPGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQRDEYPPPARRQQETLDVGSFQ
• Gene ID - Mouse: ENSMUSG00000026969
• Gene ID - Rat: ENSRNOG00000010019
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.