Anti FAM162B pAb (ATL-HPA060342 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA060342-25

Protein Description: family with sequence similarity 162, member B
Gene Name: FAM162B
Alternative Gene Name: bA86F4.2, C6orf189
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019909: 63%, ENSRNOG00000002255: 42%
Entrez Gene ID: 221303
Uniprot ID: Q5T6X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPCYSSGGAPSNSGPQGHGEIHRVPTQRRPSQFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKAR
• Gene Sequence: LPCYSSGGAPSNSGPQGHGEIHRVPTQRRPSQFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKAR
• Gene ID - Mouse: ENSMUSG00000019909
• Gene ID - Rat: ENSRNOG00000002255
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.