Anti FAM122A pAb (ATL-HPA056646)

Atlas Antibodies

Catalog No.: ATL-HPA056646-25

Protein Description: family with sequence similarity 122A
Gene Name: FAM122A
Alternative Gene Name: C9orf42, MGC17347
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074922: 98%, ENSRNOG00000051051: 96%
Entrez Gene ID: 116224
Uniprot ID: Q96E09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDE
• Gene Sequence: AQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDE
• Gene ID - Mouse: ENSMUSG00000074922
• Gene ID - Rat: ENSRNOG00000051051
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.