Anti FAM117B pAb (ATL-HPA028746)

Atlas Antibodies

Catalog No.: ATL-HPA028746-25

Protein Description: family with sequence similarity 117, member B
Gene Name: FAM117B
Alternative Gene Name: ALS2CR13, FLJ38771
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041040: 89%, ENSRNOG00000004417: 33%
Entrez Gene ID: 150864
Uniprot ID: Q6P1L5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLGTVSSPSSSPTHLWTGEVSAAPPPARVRHRRRSPEQSRSSPEKRSPSAPVCKAGDKTRQPSSSPSSIIRRTSSLDTLAAPYLAGHWPRDSHGQAAPCMRDKATQTESAWAEEYSEKKKGSH
• Gene Sequence: LLGTVSSPSSSPTHLWTGEVSAAPPPARVRHRRRSPEQSRSSPEKRSPSAPVCKAGDKTRQPSSSPSSIIRRTSSLDTLAAPYLAGHWPRDSHGQAAPCMRDKATQTESAWAEEYSEKKKGSH
• Gene ID - Mouse: ENSMUSG00000041040
• Gene ID - Rat: ENSRNOG00000004417
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.