Anti FAM114A2 pAb (ATL-HPA035869)

Atlas Antibodies

Catalog No.: ATL-HPA035869-100

Protein Description: family with sequence similarity 114, member A2
Gene Name: FAM114A2
Alternative Gene Name: 133K02, C5orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020523: 80%, ENSRNOG00000002423: 43%
Entrez Gene ID: 10827
Uniprot ID: Q9NRY5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFTKDITELFSQLHVSSKPEKLARARNTAHEWIRKSLTKPLAENEEGEKQSEAENTEQVNKNSIEDIHAFAIRSLAELTACSIELFHKTA
• Gene Sequence: DFTKDITELFSQLHVSSKPEKLARARNTAHEWIRKSLTKPLAENEEGEKQSEAENTEQVNKNSIEDIHAFAIRSLAELTACSIELFHKTA
• Gene ID - Mouse: ENSMUSG00000020523
• Gene ID - Rat: ENSRNOG00000002423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.