Anti FAM103A1 pAb (ATL-HPA041948 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041948-25

Protein Description: family with sequence similarity 103, member A1
Gene Name: FAM103A1
Alternative Gene Name: C15orf18, HsT19360, MGC2560, RAM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038646: 86%, ENSRNOG00000019426: 86%
Entrez Gene ID: 83640
Uniprot ID: Q9BTL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQ
• Gene Sequence: MTDTAEAVPKFEEMFASRFTENDKEYQEYLKRPPESPPIVEEWNSRAGGNQRNRGNRLQ
• Gene ID - Mouse: ENSMUSG00000038646
• Gene ID - Rat: ENSRNOG00000019426
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.