Anti FAHD1 pAb (ATL-HPA043534 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043534-100

Protein Description: fumarylacetoacetate hydrolase domain containing 1
Gene Name: FAHD1
Alternative Gene Name: C16orf36, DKFZP566J2046
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045316: 93%, ENSRNOG00000014727: 94%
Entrez Gene ID: 81889
Uniprot ID: Q6P587
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGT
• Gene Sequence: DECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGT
• Gene ID - Mouse: ENSMUSG00000045316
• Gene ID - Rat: ENSRNOG00000014727
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAHD1 pAb (ATL-HPA043534 w/enhanced validation) – 1 Found

Weiss, Alexander K H; Albertini, Eva; Holzknecht, Max; Cappuccio, Elia; Dorigatti, Ilaria; Krahbichler, Anna; Damisch, Elisabeth; Gstach, Hubert; Jansen-Dürr, Pidder. Regulation of cellular senescence by eukaryotic members of the FAH superfamily - A role in calcium homeostasis?. Mechanisms Of Ageing And Development. 2020;190( 32574647):111284.