Anti EVA1C pAb (ATL-HPA029944 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029944-25

• 

Protein Description: eva-1 homolog C (C. elegans)
Gene Name: EVA1C
Alternative Gene Name: B18, B19, C21orf63, C21orf64, FAM176C, PRED34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039903: 84%, ENSRNOG00000002072: 85%
Entrez Gene ID: 59271
Uniprot ID: P58658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY
• Gene Sequence: PSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY
• Gene ID - Mouse: ENSMUSG00000039903
• Gene ID - Rat: ENSRNOG00000002072
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.