Anti ETFA pAb (ATL-HPA024089 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024089-25

• 
• 
• 

Protein Description: electron-transfer-flavoprotein, alpha polypeptide
Gene Name: ETFA
Alternative Gene Name: EMA, GA2, MADD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032314: 94%, ENSRNOG00000015233: 93%
Entrez Gene ID: 2108
Uniprot ID: P13804
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGSASSEKASSTSPVEISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAA
• Gene Sequence: GGSASSEKASSTSPVEISEWLDQKLTKSDRPELTGAKVVVSGGRGLKSGENFKLLYDLADQLHAAVGASRAA
• Gene ID - Mouse: ENSMUSG00000032314
• Gene ID - Rat: ENSRNOG00000015233
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.