Anti ESR1 pAb (ATL-HPA000450 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA000450-25

• 
• 

Protein Description: estrogen receptor 1
Gene Name: ESR1
Alternative Gene Name: Era, ESR, NR3A1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019768: 89%, ENSRNOG00000019358: 89%
Entrez Gene ID: 2099
Uniprot ID: P03372
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYIT
• Gene Sequence: LQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYIT
• Gene ID - Mouse: ENSMUSG00000019768
• Gene ID - Rat: ENSRNOG00000019358
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ESR1 pAb (ATL-HPA000450 w/enhanced validation) – 3 Found

Meng, Jin; Wang, Lianghai; Hou, Jun; Yang, Xiaofeng; Lin, Ke; Nan, Hongxing; Li, Man; Wu, Xiangwei; Chen, Xueling. CCL23 suppresses liver cancer progression through the CCR1/AKT/ESR1 feedback loop. Cancer Science. 2021;112(8):3099-3110. 

Algenäs, Cajsa; Agaton, Charlotta; Fagerberg, Linn; Asplund, Anna; Björling, Lisa; Björling, Erik; Kampf, Caroline; Lundberg, Emma; Nilsson, Peter; Persson, Anja; Wester, Kenneth; Pontén, Fredrik; Wernérus, Henrik; Uhlén, Mathias; Ottosson Takanen, Jenny; Hober, Sophia. Antibody performance in western blot applications is context-dependent. Biotechnology Journal. 2014;9(3):435-45. 

Sanchez, Maria I G Lopez; Shearwood, Anne-Marie J; Chia, Tiongsun; Davies, Stefan M K; Rackham, Oliver; Filipovska, Aleksandra. Estrogen-mediated regulation of mitochondrial gene expression. Molecular Endocrinology (Baltimore, Md.). 2015;29(1):14-27.