Anti ERN2 pAb (ATL-HPA076875)

Atlas Antibodies

Catalog No.: ATL-HPA076875-25

Protein Description: endoplasmic reticulum to nucleus signaling 2
Gene Name: ERN2
Alternative Gene Name: IRE1b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030866: 65%, ENSRNOG00000018974: 61%
Entrez Gene ID: 10595
Uniprot ID: Q76MJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEKTPDSYLGLGPQD
• Gene Sequence: HHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEKTPDSYLGLGPQD
• Gene ID - Mouse: ENSMUSG00000030866
• Gene ID - Rat: ENSRNOG00000018974
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.