Anti ERMN pAb (ATL-HPA038295 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038295-25

• 
• 

Protein Description: ermin, ERM-like protein
Gene Name: ERMN
Alternative Gene Name: ERMIN, JN, KIAA1189
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026830: 66%, ENSRNOG00000021472: 69%
Entrez Gene ID: 57471
Uniprot ID: Q8TAM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRK
• Gene Sequence: LHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRK
• Gene ID - Mouse: ENSMUSG00000026830
• Gene ID - Rat: ENSRNOG00000021472
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ERMN pAb (ATL-HPA038295 w/enhanced validation) – 1 Found

Leitner, Dominique F; Mills, James D; Pires, Geoffrey; Faustin, Arline; Drummond, Eleanor; Kanshin, Evgeny; Nayak, Shruti; Askenazi, Manor; Verducci, Chloe; Chen, Bei Jun; Janitz, Michael; Anink, Jasper J; Baayen, Johannes C; Idema, Sander; van Vliet, Erwin A; Devore, Sasha; Friedman, Daniel; Diehl, Beate; Scott, Catherine; Thijs, Roland; Wisniewski, Thomas; Ueberheide, Beatrix; Thom, Maria; Aronica, Eleonora; Devinsky, Orrin. Proteomics and Transcriptomics of the Hippocampus and Cortex in SUDEP and High-Risk SUDEP Patients. Neurology. 2021;96(21):e2639-e2652.