Anti ERICH5 pAb (ATL-HPA025070 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA025070-25

• 
• 

Protein Description: glutamate-rich 5
Gene Name: ERICH5
Alternative Gene Name: C8orf47, FLJ39553
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044726: 47%, ENSRNOG00000005956: 51%
Entrez Gene ID: 203111
Uniprot ID: Q6P6B1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPQGTVGKDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDRSQLVEK
• Gene Sequence: QPQGTVGKDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDRSQLVEK
• Gene ID - Mouse: ENSMUSG00000044726
• Gene ID - Rat: ENSRNOG00000005956
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.