Anti ERCC6L2 pAb (ATL-HPA022422)

Atlas Antibodies

SKU: ATL-HPA022422-25

• 

Protein Description: ERCC excision repair 6 like 2
Gene Name: ERCC6L2
Alternative Gene Name: C9orf102, FLJ37706, RAD26L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051495: 30%, ENSRNOG00000019175: 48%
Entrez Gene ID: 375748
Uniprot ID: Q5T890
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPPAHKLEMPRQPDCQECRGTEQAAEPLAKEACDLCSDFSDEEPVGATGIKTAKNKAPDSSKASSSPGQLTLLQCGFSKL
• Gene Sequence: GPPAHKLEMPRQPDCQECRGTEQAAEPLAKEACDLCSDFSDEEPVGATGIKTAKNKAPDSSKASSSPGQLTLLQCGFSKL
• Gene ID - Mouse: ENSMUSG00000051495
• Gene ID - Rat: ENSRNOG00000019175
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.