Anti-ERBB3 pAb (ATL-HPA070524)

Atlas Antibodies

Catalog No.:
ATL-HPA070524-100
Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10<br/>Lane 2: RT-4<br/>Lane 3: U-251MG<br/>Lane 4: Human Plasma<br/>Lane 5: Liver<br/>Lane 6: Tonsil
Shipping:
Calculated at Checkout
$486.00
Adding to cart… The item has been added
Polyclonal Antibody against Human ERBB3, Gene description: erb-b2 receptor tyrosine kinase 3, Alternative Gene Names: HER3, LCCS2, Validated applications: WB, IHC, Uniprot ID: P21860, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQ
Gene Sequence PIMPTAGTTPDEDYEYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATDSAFDNPDYWHSRLFPKANAQ
Gene ID - Mouse ENSMUSG00000018166
Gene ID - Rat ENSRNOG00000004964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-ERBB3 pAb (ATL-HPA070524)
Vendor Page Anti-ERBB3 pAb (ATL-HPA070524) at Atlas Antibodies

Documents & Links for Anti-ERBB3 pAb (ATL-HPA070524)
Vendor Page Anti-ERBB3 pAb (ATL-HPA070524)
!