Anti EOMES pAb (ATL-HPA028896)

Atlas Antibodies

Catalog No.: ATL-HPA028896-25

Protein Description: eomesodermin
Gene Name: EOMES
Alternative Gene Name: TBR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032446: 96%, ENSRNOG00000042140: 96%
Entrez Gene ID: 8320
Uniprot ID: O95936
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGFRDNYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTV
• Gene Sequence: KGFRDNYDSMYTASENDRLTPSPTDSPRSHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGSYQRKMAAGLPWTSRTSPTV
• Gene ID - Mouse: ENSMUSG00000032446
• Gene ID - Rat: ENSRNOG00000042140
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EOMES pAb (ATL-HPA028896) – 3 Found

González-Arnay, Emilio; González-Gómez, Miriam; Meyer, Gundela. A Radial Glia Fascicle Leads Principal Neurons from the Pallial-Subpallial Boundary into the Developing Human Insula. Frontiers In Neuroanatomy. 11( 29259547):111. 

Yamashita, Wataru; Takahashi, Masanori; Kikkawa, Takako; Gotoh, Hitoshi; Osumi, Noriko; Ono, Katsuhiko; Nomura, Tadashi. Conserved and divergent functions of Pax6 underlie species-specific neurogenic patterns in the developing amniote brain. Development (Cambridge, England). 2018;145(8) 

Kim, Bumsoo; Koh, Yongjun; Do, Hyunsu; Ju, Younghee; Choi, Jong Bin; Cho, Gahyang; Yoo, Han-Wook; Lee, Beom Hee; Han, Jinju; Park, Jong-Eun; Han, Yong-Mahn. Aberrant Cortical Layer Development of Brain Organoids Derived from Noonan Syndrome-iPSCs. International Journal Of Molecular Sciences. 2022;23(22)