Anti EML4 pAb (ATL-HPA036688 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036688-25

Protein Description: echinoderm microtubule associated protein like 4
Gene Name: EML4
Alternative Gene Name: C2orf2, ELP120, ROPP120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032624: 64%, ENSRNOG00000030294: 66%
Entrez Gene ID: 27436
Uniprot ID: Q9HC35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEES
• Gene Sequence: MSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEES
• Gene ID - Mouse: ENSMUSG00000032624
• Gene ID - Rat: ENSRNOG00000030294
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EML4 pAb (ATL-HPA036688 w/enhanced validation) – 1 Found

Madgwick, Alicia; Fort, Philippe; Hanson, Peter S; Thibault, Philippe; Gaudreau, Marie-Claude; Lutfalla, Georges; Möröy, Tarik; Abou Elela, Sherif; Chaudhry, Bill; Elliott, David J; Morris, Christopher M; Venables, Julian P. Neural differentiation modulates the vertebrate brain specific splicing program. Plos One. 10(5):e0125998.