Anti EMC9 pAb (ATL-HPA078254)

Atlas Antibodies

Catalog No.: ATL-HPA078254-25

Protein Description: ER membrane protein complex subunit 9
Gene Name: EMC9
Alternative Gene Name: C14orf122, CGI-112, FAM158A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022217: 92%, ENSRNOG00000019162: 92%
Entrez Gene ID: 51016
Uniprot ID: Q9Y3B6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDC
• Gene Sequence: AEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDC
• Gene ID - Mouse: ENSMUSG00000022217
• Gene ID - Rat: ENSRNOG00000019162
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.