Anti EMC7 pAb (ATL-HPA047572)

Atlas Antibodies

SKU: ATL-HPA047572-25

• 

Protein Description: ER membrane protein complex subunit 7
Gene Name: EMC7
Alternative Gene Name: C11orf3, C15orf24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055943: 98%, ENSRNOG00000005884: 98%
Entrez Gene ID: 56851
Uniprot ID: Q9NPA0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGW
• Gene Sequence: VVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGW
• Gene ID - Mouse: ENSMUSG00000055943
• Gene ID - Rat: ENSRNOG00000005884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.