Anti ELL3 pAb (ATL-HPA073494)

Atlas Antibodies

SKU: ATL-HPA073494-25

• 

Protein Description: elongation factor for RNA polymerase II 3
Gene Name: ELL3
Alternative Gene Name: FLJ22637
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027246: 70%, ENSRNOG00000022868: 70%
Entrez Gene ID: 80237
Uniprot ID: Q9HB65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYE
• Gene Sequence: LPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYE
• Gene ID - Mouse: ENSMUSG00000027246
• Gene ID - Rat: ENSRNOG00000022868
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.