Anti EIF3K pAb (ATL-HPA045446 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA045446-100

Protein Description: eukaryotic translation initiation factor 3, subunit K
Gene Name: EIF3K
Alternative Gene Name: ARG134, eIF3k, EIF3S12, HSPC029, M9, PLAC-24, PRO1474, PTD001
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053565: 100%, ENSRNOG00000020495: 78%
Entrez Gene ID: 27335
Uniprot ID: Q9UBQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKA
• Gene Sequence: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKA
• Gene ID - Mouse: ENSMUSG00000053565
• Gene ID - Rat: ENSRNOG00000020495
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.