Anti-EIF2B4 pAb (ATL-HPA068855)

Atlas Antibodies

Catalog No.:
ATL-HPA068855-100
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunofluorescent staining of human cell line Hep-G2 shows localization to endoplasmic reticulum.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Polyclonal Antibody against Human EIF2B4, Gene description: eukaryotic translation initiation factor 2B subunit delta, Alternative Gene Names: DKFZP586J0119, EIF-2B, EIF2B, EIF2Bdelta, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UI10, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER
Gene Sequence VGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPETGSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAER
Gene ID - Mouse ENSMUSG00000029145
Gene ID - Rat ENSRNOG00000005301
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-EIF2B4 pAb (ATL-HPA068855)
Vendor Page Anti-EIF2B4 pAb (ATL-HPA068855) at Atlas Antibodies

Documents & Links for Anti-EIF2B4 pAb (ATL-HPA068855)
Vendor Page Anti-EIF2B4 pAb (ATL-HPA068855)
!