Anti EHD1 pAb (ATL-HPA067747 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA067747-25

Protein Description: EH-domain containing 1
Gene Name: EHD1
Alternative Gene Name: FLJ42622, FLJ44618, H-PAST, HPAST1, PAST1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000107039: 71%, ENSRNOG00000043503: 71%
Entrez Gene ID: 10938
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEQPGTAASPVSGSMFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLP
• Gene Sequence: MEQPGTAASPVSGSMFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLP
• Gene ID - Mouse: ENSMUSG00000107039
• Gene ID - Rat: ENSRNOG00000043503
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.