Anti EHBP1 pAb (ATL-HPA035468 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035468-25

• 
• 
• 

Protein Description: EH domain binding protein 1
Gene Name: EHBP1
Alternative Gene Name: KIAA0903, NACSIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042302: 69%, ENSRNOG00000008917: 76%
Entrez Gene ID: 23301
Uniprot ID: Q8NDI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSPTSKLGYSYSRDLDLAKKKHASLRQTESDPDADRTTLNHADHSSKIVQHRLLSRQEELKERARVLLEQARRDAALKAGNKHNTNTATPF
• Gene Sequence: LSPTSKLGYSYSRDLDLAKKKHASLRQTESDPDADRTTLNHADHSSKIVQHRLLSRQEELKERARVLLEQARRDAALKAGNKHNTNTATPF
• Gene ID - Mouse: ENSMUSG00000042302
• Gene ID - Rat: ENSRNOG00000008917
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.