Anti EGFR pAb (ATL-HPA001200 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001200-25

Protein Description: epidermal growth factor receptor
Gene Name: EGFR
Alternative Gene Name: ERBB, ERBB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020122: 90%, ENSRNOG00000004332: 91%
Entrez Gene ID: 1956
Uniprot ID: P00533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
• Gene Sequence: EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS
• Gene ID - Mouse: ENSMUSG00000020122
• Gene ID - Rat: ENSRNOG00000004332
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EGFR pAb (ATL-HPA001200 w/enhanced validation) – 2 Found

Terp, Mikkel G; Jacobsen, Kirstine; Molina, Miguel Angel; Karachaliou, Niki; Beck, Hans C; Bertran-Alamillo, Jordi; Giménez-Capitán, Ana; Cardona, Andrés F; Rosell, Rafael; Ditzel, Henrik J. Combined FGFR and Akt pathway inhibition abrogates growth of FGFR1 overexpressing EGFR-TKI-resistant NSCLC cells. Npj Precision Oncology. 2021;5(1):65. 

Hudson, Elton P; Uhlen, Mathias; Rockberg, Johan. Multiplex epitope mapping using bacterial surface display reveals both linear and conformational epitopes. Scientific Reports. 2( 23050090):706.