Anti EFR3A pAb (ATL-HPA023402 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023402-25

• 
• 
• 

Protein Description: EFR3 homolog A (S. cerevisiae)
Gene Name: EFR3A
Alternative Gene Name: KIAA0143
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015002: 95%, ENSRNOG00000025528: 96%
Entrez Gene ID: 23167
Uniprot ID: Q14156
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAVPAFCQHVSKVIEIRTMEAPYFLPEHIFRDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRL
• Gene Sequence: IAVPAFCQHVSKVIEIRTMEAPYFLPEHIFRDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRL
• Gene ID - Mouse: ENSMUSG00000015002
• Gene ID - Rat: ENSRNOG00000025528
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.