Anti EFEMP1 pAb (ATL-HPA070841 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA070841-25

Protein Description: EGF containing fibulin-like extracellular matrix protein 1
Gene Name: EFEMP1
Alternative Gene Name: DHRD, FBLN3, FBNL, MTLV, S1-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020467: 94%, ENSRNOG00000003553: 93%
Entrez Gene ID: 2202
Uniprot ID: Q12805
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG
• Gene Sequence: RRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAGTHNCRADQVCINLRGSFACQCPPGYQKRG
• Gene ID - Mouse: ENSMUSG00000020467
• Gene ID - Rat: ENSRNOG00000003553
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.