Anti EFCAB7 pAb (ATL-HPA029612 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029612-25

• 

Protein Description: EF-hand calcium binding domain 7
Gene Name: EFCAB7
Alternative Gene Name: KIAA1799, RP4-534K7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073791: 87%, ENSRNOG00000009782: 87%
Entrez Gene ID: 84455
Uniprot ID: A8K855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WTGELGPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGNGLLSLEEYNFFELRTSGEKCDEDAWAVC
• Gene Sequence: WTGELGPGIYWLIPSTTGCRLRKKIKPVTDEAQLVYRDETGELFLTKEFKSTLSDIFEVIDLDGNGLLSLEEYNFFELRTSGEKCDEDAWAVC
• Gene ID - Mouse: ENSMUSG00000073791
• Gene ID - Rat: ENSRNOG00000009782
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.