Anti ECHDC1 pAb (ATL-HPA035445)

Atlas Antibodies

SKU: ATL-HPA035445-25

• 

Protein Description: enoyl CoA hydratase domain containing 1
Gene Name: ECHDC1
Alternative Gene Name: dJ351K20.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019883: 74%, ENSRNOG00000011622: 71%
Entrez Gene ID: 55862
Uniprot ID: Q9NTX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAF
• Gene Sequence: MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAF
• Gene ID - Mouse: ENSMUSG00000019883
• Gene ID - Rat: ENSRNOG00000011622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.