Anti EBF2 pAb (ATL-HPA055101)

Atlas Antibodies

Catalog No.: ATL-HPA055101-25

Protein Description: early B cell factor 2
Gene Name: EBF2
Alternative Gene Name: COE2, FLJ11500
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022053: 100%, ENSRNOG00000011548: 100%
Entrez Gene ID: 64641
Uniprot ID: Q9HAK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPF
• Gene Sequence: PGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPF
• Gene ID - Mouse: ENSMUSG00000022053
• Gene ID - Rat: ENSRNOG00000011548
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.