Anti EBAG9 pAb (ATL-HPA021153 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021153-25

• 

Protein Description: estrogen receptor binding site associated, antigen, 9
Gene Name: EBAG9
Alternative Gene Name: EB9, RCAS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022339: 99%, ENSRNOG00000004220: 94%
Entrez Gene ID: 9166
Uniprot ID: O00559
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
• Gene Sequence: RGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGI
• Gene ID - Mouse: ENSMUSG00000022339
• Gene ID - Rat: ENSRNOG00000004220
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.