Anti EAF1 pAb (ATL-HPA069538 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA069538-25

Protein Description: ELL associated factor 1
Gene Name: EAF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021890: 96%, ENSRNOG00000019559: 91%
Entrez Gene ID: 85403
Uniprot ID: Q96JC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNTLRN
• Gene Sequence: GSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNTLRN
• Gene ID - Mouse: ENSMUSG00000021890
• Gene ID - Rat: ENSRNOG00000019559
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.