Anti-DYNC1LI2 pAb (ATL-HPA049538)

Atlas Antibodies

Catalog No.:
ATL-HPA049538-100
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Polyclonal Antibody against Human DYNC1LI2, Gene description: dynein cytoplasmic 1 light intermediate chain 2, Alternative Gene Names: DNCLI2, Validated applications: IHC, WB, Uniprot ID: O43237, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTE
Gene Sequence PGSPGAGGVQSTAKKSGQKTVLSNVQEELDRMTRKPDSMVTNSSTE
Gene ID - Mouse ENSMUSG00000035770
Gene ID - Rat ENSRNOG00000025791
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti-DYNC1LI2 pAb (ATL-HPA049538)
Vendor Page Anti-DYNC1LI2 pAb (ATL-HPA049538) at Atlas Antibodies

Documents & Links for Anti-DYNC1LI2 pAb (ATL-HPA049538)
Vendor Page Anti-DYNC1LI2 pAb (ATL-HPA049538)
!