Anti DUS2 pAb (ATL-HPA042560 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042560-25

Protein Description: dihydrouridine synthase 2
Gene Name: DUS2
Alternative Gene Name: DUS2L, FLJ20399, SMM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031901: 98%, ENSRNOG00000019819: 96%
Entrez Gene ID: 54920
Uniprot ID: Q9NX74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDDRVVFRTCEREQNRVVFQMGT
• Gene Sequence: SLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDDRVVFRTCEREQNRVVFQMGT
• Gene ID - Mouse: ENSMUSG00000031901
• Gene ID - Rat: ENSRNOG00000019819
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.