Anti DTX4 pAb (ATL-HPA059294)

Atlas Antibodies

SKU: ATL-HPA059294-25

• 
• 

Protein Description: deltex 4, E3 ubiquitin ligase
Gene Name: DTX4
Alternative Gene Name: KIAA0937, RNF155
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039982: 86%, ENSRNOG00000021086: 85%
Entrez Gene ID: 23220
Uniprot ID: Q9Y2E6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSP
• Gene Sequence: DSTGTIRGPLKTAPSQVIRRQASSMPTGTTMGSPASPPGPNSKTGRVALATLNRTNLQRLAIAQSRVLIASGVPTVPVKNLNGSSP
• Gene ID - Mouse: ENSMUSG00000039982
• Gene ID - Rat: ENSRNOG00000021086
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.