Anti DPYSL5 pAb (ATL-HPA034544 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA034544-25

• 

Protein Description: dihydropyrimidinase-like 5
Gene Name: DPYSL5
Alternative Gene Name: CRAM, CRMP-5, CRMP5, Ulip6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029168: 98%, ENSRNOG00000054165: 98%
Entrez Gene ID: 56896
Uniprot ID: Q9BPU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYL
• Gene Sequence: GRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRTPYL
• Gene ID - Mouse: ENSMUSG00000029168
• Gene ID - Rat: ENSRNOG00000054165
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.