Anti DPPA2 pAb (ATL-HPA036134 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036134-25

Protein Description: developmental pluripotency associated 2
Gene Name: DPPA2
Alternative Gene Name: CT100, PESCRG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072419: 37%, ENSRNOG00000025404: 28%
Entrez Gene ID: 151871
Uniprot ID: Q7Z7J5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG
• Gene Sequence: DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG
• Gene ID - Mouse: ENSMUSG00000072419
• Gene ID - Rat: ENSRNOG00000025404
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.