Anti DNAJC21 pAb (ATL-HPA040789)

Atlas Antibodies

SKU: ATL-HPA040789-25

• 

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 21
Gene Name: DNAJC21
Alternative Gene Name: DNAJA5, GS3, JJJ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044224: 96%, ENSRNOG00000017876: 100%
Entrez Gene ID: 134218
Uniprot ID: Q5F1R6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HPFYAYWQSFCTQKNFAWKEEYDTRQASNRWEKRAMEKENKKIRDKARKEKNELVRQLVAFIRKRDKRVQAHRKLVEEQNA
• Gene Sequence: HPFYAYWQSFCTQKNFAWKEEYDTRQASNRWEKRAMEKENKKIRDKARKEKNELVRQLVAFIRKRDKRVQAHRKLVEEQNA
• Gene ID - Mouse: ENSMUSG00000044224
• Gene ID - Rat: ENSRNOG00000017876
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.