Anti DNAJC11 pAb (ATL-HPA028705)

Atlas Antibodies

Catalog No.: ATL-HPA028705-25

Protein Description: DnaJ (Hsp40) homolog, subfamily C, member 11
Gene Name: DNAJC11
Alternative Gene Name: FLJ10737
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039768: 96%, ENSRNOG00000008802: 94%
Entrez Gene ID: 55735
Uniprot ID: Q9NVH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AWYGKFVNDKSRKSEKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDPCVGEEKNLKVLYQFRGVLHQVMVLDSEALRIPKQSHRI
• Gene Sequence: AWYGKFVNDKSRKSEKVKVIDVTVPLQCLVKDSKLILTEASKAGLPGFYDPCVGEEKNLKVLYQFRGVLHQVMVLDSEALRIPKQSHRI
• Gene ID - Mouse: ENSMUSG00000039768
• Gene ID - Rat: ENSRNOG00000008802
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.