Anti DNAI2 pAb (ATL-HPA050565 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA050565-25

Protein Description: dynein, axonemal, intermediate chain 2
Gene Name: DNAI2
Alternative Gene Name: CILD9, DIC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034706: 90%, ENSRNOG00000024523: 91%
Entrez Gene ID: 64446
Uniprot ID: Q9GZS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAI
• Gene Sequence: IVYVYVKKRSEFGKQCNFSDRQAELNIDIMPNPELAEQFVERNPVDTGIQCSISMSEHEANSERFEMETRGVNHVEGGWPKDVNPLELEQTIRFRKKVEKDENYVNAIMQLGSIMEHCIKQNNAI
• Gene ID - Mouse: ENSMUSG00000034706
• Gene ID - Rat: ENSRNOG00000024523
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DNAI2 pAb (ATL-HPA050565 w/enhanced validation) – 1 Found

Al-Mutairi, Dalal A; Alsabah, Basel H; Alkhaledi, Bashar A; Pennekamp, Petra; Omran, Heymut. Identification of a novel founder variant in DNAI2 cause primary ciliary dyskinesia in five consanguineous families derived from a single tribe descendant of Arabian Peninsula. Frontiers In Genetics. 13( 36303540):1017280.