Anti DNAH7 pAb (ATL-HPA034724)

Atlas Antibodies

Catalog No.: ATL-HPA034724-25

Protein Description: dynein, axonemal, heavy chain 7
Gene Name: DNAH7
Alternative Gene Name: KIAA0944
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041144: 88%, ENSRNOG00000060984: 91%
Entrez Gene ID: 56171
Uniprot ID: Q8WXX0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY
• Gene Sequence: LKLRCERFVEELESYAKQSEEFYSFGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNY
• Gene ID - Mouse: ENSMUSG00000041144
• Gene ID - Rat: ENSRNOG00000060984
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.