Anti DLK1 pAb (ATL-HPA062262 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA062262-25

Protein Description: delta-like 1 homolog (Drosophila)
Gene Name: DLK1
Alternative Gene Name: Delta1, FA1, pG2, Pref-1, ZOG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098411: 83%, ENSRNOG00000019584: 83%
Entrez Gene ID: 8788
Uniprot ID: P80370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
• Gene Sequence: FTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
• Gene ID - Mouse: ENSMUSG00000098411
• Gene ID - Rat: ENSRNOG00000019584
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.