Anti DKC1 pAb (ATL-HPA001022)

Atlas Antibodies

Catalog No.: ATL-HPA001022-25

Protein Description: dyskeratosis congenita 1, dyskerin
Gene Name: DKC1
Alternative Gene Name: DKC, dyskerin, NAP57, NOLA4, XAP101
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031403: 94%, ENSRNOG00000055562: 86%
Entrez Gene ID: 1736
Uniprot ID: O60832
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL
• Gene Sequence: KERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACGSNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTL
• Gene ID - Mouse: ENSMUSG00000031403
• Gene ID - Rat: ENSRNOG00000055562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti DKC1 pAb (ATL-HPA001022) – 1 Found

Andrades, Evelyn; Toll, Agustí; Deza, Gustavo; Segura, Sonia; Gimeno, Ramón; Espadas, Guadalupe; Sabidó, Eduard; Haro, Noemí; Pozo, Óscar J; Bódalo, Marta; Torres, Paloma; Pujol, Ramon M; Hernández-Muñoz, Inmaculada. Loss of dyskerin facilitates the acquisition of metastatic traits by altering the mevalonate pathway. Life Science Alliance. 2023;6(4)