Anti DISP1 pAb (ATL-HPA051411)

Atlas Antibodies

Catalog No.: ATL-HPA051411-25

Protein Description: dispatched homolog 1 (Drosophila)
Gene Name: DISP1
Alternative Gene Name: DISPA, DKFZP434I0428, MGC13130, MGC16796
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030768: 46%, ENSRNOG00000003635: 40%
Entrez Gene ID: 84976
Uniprot ID: Q96F81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKTNVHSLQRSIEEHLPKMAEPSSFVCRSTGSLLKTCCDPENKQRELCKNRDVSNLESSGGTENKAGGKVELSLSQTDASVNSE
• Gene Sequence: GKTNVHSLQRSIEEHLPKMAEPSSFVCRSTGSLLKTCCDPENKQRELCKNRDVSNLESSGGTENKAGGKVELSLSQTDASVNSE
• Gene ID - Mouse: ENSMUSG00000030768
• Gene ID - Rat: ENSRNOG00000003635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.