Anti DIRAS3 pAb (ATL-HPA028483 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028483-25

Protein Description: DIRAS family, GTP-binding RAS-like 3
Gene Name: DIRAS3
Alternative Gene Name: ARHI, NOEY2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047842: 45%, ENSRNOG00000032328: 45%
Entrez Gene ID: 9077
Uniprot ID: O95661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
• Gene Sequence: SDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
• Gene ID - Mouse: ENSMUSG00000047842
• Gene ID - Rat: ENSRNOG00000032328
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.