Anti DHRS2 pAb (ATL-HPA053915)

Atlas Antibodies

SKU: ATL-HPA053915-25

• 
• 

Protein Description: dehydrogenase/reductase (SDR family) member 2
Gene Name: DHRS2
Alternative Gene Name: HEP27, SDR25C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022209: 80%, ENSRNOG00000018177: 80%
Entrez Gene ID: 10202
Uniprot ID: Q13268
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
• Gene Sequence: EDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQL
• Gene ID - Mouse: ENSMUSG00000022209
• Gene ID - Rat: ENSRNOG00000018177
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.