Anti DENND6B pAb (ATL-HPA021653)

Atlas Antibodies

SKU: ATL-HPA021653-25

• 
• 

Protein Description: DENN/MADD domain containing 6B
Gene Name: DENND6B
Alternative Gene Name: AFI1B, FAM116B, MGC33692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015377: 91%, ENSRNOG00000029866: 92%
Entrez Gene ID: 414918
Uniprot ID: Q8NEG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNLPVMGVVVQVRIPSRVDKSESSPPKQFDQENLLPAPVVLASVHELDLFRCFRPVLTHMQTLWELMLLGEPLLVLAP
• Gene Sequence: LNLPVMGVVVQVRIPSRVDKSESSPPKQFDQENLLPAPVVLASVHELDLFRCFRPVLTHMQTLWELMLLGEPLLVLAP
• Gene ID - Mouse: ENSMUSG00000015377
• Gene ID - Rat: ENSRNOG00000029866
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.