Anti DDX59 pAb (ATL-HPA047166 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA047166-25

Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 59
Gene Name: DDX59
Alternative Gene Name: DKFZP564B1023, ZNHIT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026404: 85%, ENSRNOG00000042451: 81%
Entrez Gene ID: 83479
Uniprot ID: Q5T1V6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIIL
• Gene Sequence: VELCGVKIVVVDEADTMLKMGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQIIL
• Gene ID - Mouse: ENSMUSG00000026404
• Gene ID - Rat: ENSRNOG00000042451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.