Anti DDX4 pAb (ATL-HPA037764 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA037764-25

• 

Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 4
Gene Name: DDX4
Alternative Gene Name: VASA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021758: 99%, ENSRNOG00000026686: 99%
Entrez Gene ID: 54514
Uniprot ID: Q9NQI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTK
• Gene Sequence: GGESSDTQGPKVTYIPPPPPEDEDSIFAHYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTK
• Gene ID - Mouse: ENSMUSG00000021758
• Gene ID - Rat: ENSRNOG00000026686
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.