Anti DDX18 pAb (ATL-HPA041056 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041056-100

Protein Description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
Gene Name: DDX18
Alternative Gene Name: MrDb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001674: 45%, ENSRNOG00000025430: 42%
Entrez Gene ID: 8886
Uniprot ID: Q9NVP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSES
• Gene Sequence: ETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSES
• Gene ID - Mouse: ENSMUSG00000001674
• Gene ID - Rat: ENSRNOG00000025430
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.